PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc03424.1.g00030.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 300aa    MW: 33365.3 Da    PI: 4.8782
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc03424.1.g00030.1.sm.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox642.2e-20110163356
                                     --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                        Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                     k++++t+eq++ Le+ Fe+++++  e+++eLA++lg+  rqV vWFqNrRa++k
  Zpz_sc03424.1.g00030.1.sm.mkhc 110 KKRRLTPEQVQMLERSFEEENKLEPERKTELARRLGMAPRQVAVWFQNRRARWK 163
                                     5678*************************************************9 PP

2HD-ZIP_I/II131.43.5e-42109200192
                     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeener 79 
                                     ekkrrl+ eqv++LE+sFeee+kLeperK+elar+Lg+ prqvavWFqnrRAR+ktkqlE++y++Lk+aydal+++++ 
  Zpz_sc03424.1.g00030.1.sm.mkhc 109 EKKRRLTPEQVQMLERSFEEENKLEPERKTELARRLGMAPRQVAVWFQNRRARWKTKQLETEYDRLKAAYDALAADHQG 187
                                     69***************************************************************************** PP

                     HD-ZIP_I/II  80 LekeveeLreelk 92 
                                     L +++ +Lr+++ 
  Zpz_sc03424.1.g00030.1.sm.mkhc 188 LLADNGNLRAQVI 200
                                     *********9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.47E-19104167IPR009057Homeodomain-like
PROSITE profilePS5007118.285105165IPR001356Homeobox domain
SMARTSM003891.1E-19108169IPR001356Homeobox domain
PfamPF000469.1E-18110163IPR001356Homeobox domain
CDDcd000862.47E-18110166No hitNo description
Gene3DG3DSA:1.10.10.601.6E-21111172IPR009057Homeodomain-like
PRINTSPR000315.1E-6136145IPR000047Helix-turn-helix motif
PROSITE patternPS000270140163IPR017970Homeobox, conserved site
PRINTSPR000315.1E-6145161IPR000047Helix-turn-helix motif
PfamPF021834.4E-15165207IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MKCLRARAPE LAGACTGSKI VFFSFSSEKK GSSMDPGRMG FDSSGVRRGE GPQMLLFGGG  60
GSANSNGFIR GVPMAVLGRD DDARVGKRPF FTTHEELMEE EYYDEQAPEK KRRLTPEQVQ  120
MLERSFEEEN KLEPERKTEL ARRLGMAPRQ VAVWFQNRRA RWKTKQLETE YDRLKAAYDA  180
LAADHQGLLA DNGNLRAQVI SLTEKLQGKV TSPSATTVAQ EVDHLDDQNV FTGMEKPLVQ  240
QFKEALGSGD RTIHGALSLE EDGGVVSDEG CSFDDFPDTL FAVRAAEEAQ LGSLDSWFWN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1157165RRARWKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0545411e-177BT054541.1 Zea mays full-length cDNA clone ZM_BFc0148O10 mRNA, complete cds.
GenBankEU9664891e-177EU966489.1 Zea mays clone 294842 homeodomain leucine zipper protein CPHB-5 mRNA, complete cds.
GenBankKJ7276101e-177KJ727610.1 Zea mays clone pUT5470 HB transcription factor (HB112) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004973433.11e-130PREDICTED: homeobox-leucine zipper protein HOX5-like
SwissprotQ6ZA744e-85HOX5_ORYSJ; Homeobox-leucine zipper protein HOX5
SwissprotQ9XH364e-85HOX5_ORYSI; Homeobox-leucine zipper protein HOX5
TrEMBLB4FLB11e-133B4FLB1_MAIZE; HB transcription factor
STRINGSi014228m1e-130(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26093887
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.13e-50homeobox 1